PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHM99094.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 311aa    MW: 35759.5 Da    PI: 7.1904
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHM99094.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.71.1e-092412752155
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 k +yps+++++ LA+++gL+ +q+ +WF N+R ++
  KHM99094.1 241 KWPYPSESQKQALAESTGLDLKQINNWFINQRKRH 275
                 569*****************************885 PP

2ELK38.42.6e-13195216122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK qLlrKYsgyLgsLk+EF+
  KHM99094.1 195 ELKVQLLRKYSGYLGSLKKEFL 216
                 9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.5E-1562106IPR005540KNOX1
PfamPF037906.5E-1964105IPR005540KNOX1
SMARTSM012562.4E-26114165IPR005541KNOX2
PfamPF037916.5E-22117163IPR005541KNOX2
PfamPF037891.9E-9195216IPR005539ELK domain
SMARTSM011887.1E-7195216IPR005539ELK domain
PROSITE profilePS5121311.139195215IPR005539ELK domain
PROSITE profilePS5007112.228215278IPR001356Homeobox domain
SMARTSM003892.8E-12217282IPR001356Homeobox domain
SuperFamilySSF466892.01E-19217289IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28220281IPR009057Homeodomain-like
CDDcd000862.50E-12227279No hitNo description
PfamPF059202.7E-17235274IPR008422Homeobox KN domain
PROSITE patternPS000270253276IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MDMMNMETNN RKFLSLPLSN NNNNSGNAQM RSSSDNRRVP VTSNSNIAQE HHYSHHNPTD  60
TCSVRDKIMA HPLFPRLLSS YLNCLKVGAP PEVVASLEES CAKCESFNAS SGRTGGSIGE  120
DPALDQFMEA YCEMLIKYEQ ELTKPFKEAM LFFSRIECQL KALAVSSDFG QSETSSQNEV  180
DVHENNLDSQ AEDRELKVQL LRKYSGYLGS LKKEFLKKKK NGKLPKEARQ QLLDWWNRHY  240
KWPYPSESQK QALAESTGLD LKQINNWFIN QRKRHWKPSE DMQFAVMDAT NYYMENVMCK  300
PFPMDGMPML L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1280610.0EF128061.1 Medicago truncatula class I KNOX homeobox transcription factor (KNOX6) mRNA, complete cds.
GenBankGU4616040.0GU461604.1 Medicago truncatula KNOX6 variant a mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003545568.10.0PREDICTED: homeobox protein SBH1-like isoform X1
RefseqXP_006595822.10.0PREDICTED: homeobox protein knotted-1-like LET6 isoform X2
SwissprotP466081e-118HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0B2NPW00.0A0A0B2NPW0_GLYSO; Homeobox protein SBH1
TrEMBLK7M4X90.0K7M4X9_SOYBN; Uncharacterized protein
TrEMBLA0A0R0GL540.0A0A0R0GL54_SOYBN; Uncharacterized protein
STRINGGLYMA14G05150.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-107KNOX/ELK homeobox transcription factor
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]